Web Analysis for Vrma - vrma.org
It is a domain having org extension. It has a global traffic rank of #474106 in the world. This website is estimated worth of $ 8,640.00 and have a daily income of around $ 24.00. As no active threats were reported recently by users, vrma.org is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
No Risk Issues
Traffic Report
| Daily Unique Visitors: | 2,663 |
| Daily Pageviews: | 7,989 |
Estimated Valuation
| Income Per Day: | $ 24.00 |
| Estimated Worth: | $ 8,640.00 |
Search Engine Indexes
| Google Indexed Pages: | 1,580 |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | 25,500 |
| Bing Backlinks: | 4,540 |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | No Risk Issues |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | 474,106 |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
38.106.217.164
Hosted Country:
US
Location Latitude:
41.8874Location Longitude:
-87.6318Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 18 |
| Google Adsense: | Not Applicable | Google Analytics: | UA-7305628-1 |
Websites Hosted on Same IP (i.e. 38.106.217.164)
Legal Marketing Association : The Authority for Legal Marketing | Home
224,870
$
39,420.00
Fiber Broadband Association : Building Fiber-to-the-Home Communities T
Fiber to the Home Council, Building Fiber-to-the-Home Communities Together
Not Applicable
$
8.95
SHARE : SHARE - Enterprise Technology IT Professionals Association - H
SHARE is an independent association user group providing IT and enterprise technology professionals with training, technical content and networking opportunities focused on IBM System z Mainframe Technology.
1,872,451
$
720.00
COE : Home
Bringing together the users of Dassault Systemes PLM solutions CATIA, ENOVIA, DELMIA and SIMULIA
638,177
$
1,920.00
HTTP Header Analysis
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content-Encoding: gzip
Content-Type: text/html; charset=ISO-8859-1
Date: Wed, 11 Dec 2019 17:00:29 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Server: AL_TEST
Vary: Accept-Encoding
Content-Length: 5992
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.smithbucklin.com |
|
38.106.212.25 |
United States of America
|
| ns2.smithbucklin.com |
|
50.31.73.7 |
United States of America
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| vrma.org | A | 299 |
IP: 38.106.217.164 |
| vrma.org | NS | 300 |
Target: ns1.smithbucklin.com |
| vrma.org | NS | 300 |
Target: ns2.smithbucklin.com |
| vrma.org | SOA | 300 |
MNAME: ns1.smithbucklin.com RNAME: hostmaster.smithbucklin.com Serial: 2019052401 Refresh: 900 Retry: 600 Expire: 86400 Minimum TTL: 300 |
| vrma.org | MX | 300 |
Priority: 10 Target: smtp03.mail.smithbucklin.com |
| vrma.org | MX | 300 |
Priority: 10 Target: smtp01.mail.smithbucklin.com |
| vrma.org | MX | 300 |
Priority: 10 Target: smtp02.mail.smithbucklin.com |
| vrma.org | TXT | 300 |
TXT: v=spf1 include:obmail.socious.net include:spf.bluehornet.com include:salsalabs.org ip4:38.106.208.0/20 ~all |
Similarly Ranked Websites
managehighlyrefinedthefile.vip - This website is for sale! - managehig
This website is for sale! managehighlyrefinedthefile.vip is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, managehighlyrefinedthefile.vip has it all. We hope you find what you are searching for!
474,107
$
8,640.00
triathlon-24.com - Ausdauershop in Aschaffenburg bei Frankfurt am Main
H is for Home - One off, handmade and vintage items for the home - Home Page
474,109
$
5,040.00
